1/6/2024 0 Comments Missionary positionreserves the right to make additions, deletions, or modification to the contents on the Website at any time without prior notice.Ĭopyright © 2013-2022. In no event shall be liable for any special, direct, indirect, consequential, or incidental damages or any damages whatsoever, whether in an action of contract, negligence or other tort, arising out of or in connection with the use of the Website or the contents of the Website. Accordingly, to the extent permitted by applicable law, we exclude all express or implied warranties, terms and conditions including, but not limited to, implied warranties of content, fitness for a particular purpose, and non-infringement. Leaning forward, she rests her entire body on his stomach and chest. She straddles him Cowgirl style, with her knees on the bed. They can be straight or he can bend them a little bit at the knee. Terms of service: You agree that you are making use of our services at your own risk, and that they are being provided to you on an "AS IS" and "AS AVAILABLE" basis. To perform the Inverted Missionary, he lies on his back with his legs together. We do our best to delete links to inappropriate content expeditiously, when it is reported. to remove a link and a thumbnail from the Website please use report button (gray X at the bottom of every video).to remove a physical video file please contact the site owner where the content is hosted.If you find inappropriate content that you believe should be removed (illegal content, copyright infringement or dead links): We do not own, produce, host or upload any videos displayed on this website, we only link to them. Super horny blonde nympho gets her wet pussy eaten out and fucked hard. By contrast, the missionary position title stands as a metaphor for the role of Christian missionaries in imposing colonial rule and oppression. Indexing process is completely automated. Banging fat and horny girl in a missionary position on a bench outdoor. has a zero-tolerance policy against illegal pornography.ĭisclaimer: (the Website) is a search engine, it only searches for porn tube movies.Īll links and thumbnails displayed on the Website are automatically added by our crawlers. The full body contact felt in the missionary position means that the body’s largest sexual organ the skin is stimulated. The penetrating partner enters so that the base of the penis rubs the clitoris. Many women particularly enjoy the basic missionary position, with the man on top and the woman underneath, because you can see your partners’ face, kiss, hug and caress each other. The penetrating partner lies on top of the receiving partner, facing them. In it, the receiving partner lies on their back with legs apart. "Why would I want to bounce all around when it feels just as good to lay on my back, relax, and look up at the man who's turning me on?" "Whoever said missionary is boring just isn't trying hard enough," another woman says.All models on this website are 18 years or older. These positions are used for vaginal, or anal sex.The basic position is called the missionary position. You can make the Missionary Sex Position even more interesting using a blindfold that can heighten senses. As a bonus, the person in charge of the penetration can hold the back, butt, and legs tight. ![]() The man only needs to lay down and enjoy. "Other positions feel really good, but missionary combines that with this intense level of emotion because your faces are so close-unless you keep your eyes closed for the entire time, you kind of have to make eye contact." "I'm just going to say the thing you're not supposed to say, and that is that I love missionary because it lets me be lazy," says another. The Missionary Sex Position above shows the woman in charge of the penetration, doing all the action. Though commonly associated with heterosexual sexual activity, the sex position is also used by gay and lesbian couples. "Missionary is just the perfect blend of intimate and fun," says one woman. The missionary position or man-on-top position is generally a sex position in which a woman lies on her back and a man lies on top of her while they face each other and engage in sexual intercourse or other sexual activity. In fact, of the 14 women I polled, nine named missionary as their favorite angle. A man I know recently called the missionary position "vanilla," but after a not-so-scientific poll of several women, I discovered many of us like to think of it more as caramel-and-chocolate-swirl ice cream, so delicious we could eat it every single night.
0 Comments
1/6/2024 0 Comments Disk drill download softonic![]() It handles with all types of data loss due to any reason, like deleted files or formatted volumes. Softtote Mac Data Recovery can recover your lost data within no time. Less reliable in terms of recovery of an important document.The software is open with its source code available to the user.First it checks the data to see if it is corrupted or not, then software is ensured to recover the file. This quality makes this software a unique one! The software uses a sophisticated technology with 2 recovery modes. The source code and even the software is available to the public. PhotoRec Mac data recovery has lots of advantages. : Disk Drill is a practical and intuitive utility that can successfully assist you in regaining access to lost or damaged files from a variety of disk or file system types, making it quite worthy for considering, should you be in the market for such a tool.Ĭ: Powerful scanning and speedy recovery makes this recovery tool stand ahead from the rest of the competitive products. Works slow on devices with bigger storage.Recovers more than 500 MB of data from different storages (internal and external).Windows 7, 8, 10 (XP and Vista), Mac OS X. This software has to offer you with data filtering, iOS recovery, and data protection. This tool provides you with effective yet quick data recovery. This amazing free data recovery software mac has an excellent yet simple design and interface with lots of new features. Link: Video Guide for How to Use UltData for Mac Also, I've heard pretty good things about Tenorshare's support so you're buying into something really solid. The $69.95 price-tag is steep, especially considering cheaper alternatives which, I must admit, are not as simple and effective as Tenorshare although comparably so. : Tenorshare iPhone Data Recovery's free version will show you all the files that it has detected (available for recovery) but in order to recover them to your computer, you'll need to register. For those with any doubts, the manufacturer offers technical support 24 hours a day, 7 days a week. You can access free trials for all iterations of the software so you can be sure it will thoroughly serve your recovery needs. Starting with the iPhone 3, support continues all the way up through iPhone 6 Plus. It supports both GSM and CDMA phone types, as demonstrated on their website. ![]() : Tenorshare is explicit about the hardware it supports. MacOS 10.15(Catalina), MacOS 10.14 (Mojave), MacOS 10.13 (High Sierra), MacOS 10.12 (Sierra), Mac OS X 10.11 (El Capitan), Mac OS X 10.9 (Mavericks), Mac OS X 10.8 (Mountain Lion), and lower versions. Wide compatibility, support, powerful features, and easy operations.Recover more than 550 file types on Mac.Then the selected files will be recovered to the destination folder. Select the lost or deleted files to recover and click on "Recover" and choose the storage destination path. Step 3 Preview the files you want to recover. Step 2 Select the locations and proceed to "Scan". Top 10 Cell Phone Data Recovery Software.Recover Data from PC after Black Screen of Death.Repair Corrupted Excel Files and Recover Data.Top 8 Solutions to SSD Not Showing Up Windows 10/8/7.Quick & Easy Solutions to SD Card Not Showing Up Windows 10/8/7.Windows 10 Not Recognizing Second Hard Drive.Fix The Parameter is Incorrect Error on External Hard Drive in Windows 10/8/7.Repair Corrupted/Damaged External Hard Drive.Transfer Files from Broken Laptop to New Laptop.Recover Files after Windows 10 System Restore.Recover Windows 10 Files without Backup.Complete Guide on How to Fix Corrupted Word File Easily.Destination Folder Access Denied Windows 10/8/7.Recover Data after Blue Screen of Death. ![]()
1/6/2024 0 Comments Honey browser extension![]() Start Using Capital One Shopping Start Using Honey You’ll also be able to create lists of products that you’re interested in,Īnd you’ll get an alert when there’s been a price drop. With both Capital One Shopping and Honey, you’ll earn credits when you shop that can be turned into gift cards for a wide range This makes it easier to shop online with your favorite online retailers. The Capital One Shopping extension is easily added to your browser, and so is Honey. Essentially, they are both online shoppingĪssistants that work in your browser to find better deals and automatically apply coupon codes before you make a How Do Capital One Shopping and Honey Work?Ĭapital One Shopping and Honey are similar in many ways, and in their overall purpose. Here’s a little more information on how each of these shopping browser extensions can help customers save money. Honey, like Capital One shopping, helps shoppers by comparing prices to help customers find the best prices on products. Shoppers can then apply their rewards, or Honey gold, to receive gift cards from select retailers. Online shoppers can also use the Honey Gold rewards program to earn shopping rewards when they use Honey. Honey automatically searches for, finds, and applies coupon codes to purchases made. Honey helps customers save money by searching for the best deals available on the products they need. Honey is another free shopping browser extension that many people use to save money when shopping online. Another browser extension that's pretty popular is called Honey. Capital One Shopping finds coupon codes for online shoppers, helps customers save money by providing a price comparison tool, gives customers shopping rewards, and allows customers to find the lowest prices on their favorite products on tens of thousands of websites.Ĭapital One Shopping can also alert customers of price drops, which is a great feature if you're not in a rush to purchase.The Capital One Shopping extension is an excellent way for customers to compare prices and save money, and it's one of the most reliable and popular shopping browser extensions out there. Getting Started with Capital One Shopping or HoneyĬapital One Shopping is a shopping browser extension that gives readers a few different ways to save money when shopping online.How Do Capital One Shopping and Honey Work?. 1/6/2024 0 Comments Isale sawab benefits![]() In the name of Allah, Most Gracious, Most MercifulĪssalaamu `alaykum waRahmatullahi WabarakatohĪttached is a response to a similar query. Therefore would be extremely grateful if i can be forwarded the articles or sent the links as a matter of urgency. I was directed to your website and was informed i will find all the necessay information however to no avail. Q) I am urgently in need of any articles regarding Esaalu Thwaab and the Virtues of Quran Recitation at graves. Passing reward to others (Isaal-e-Thawab) Shaykh (Mufti) Ebrahim Desai (HA) There is no restriction because no specific restriction has been placed by Allah (SWT) or by Rasul-ullah (Sallaho Alaihe Wassallam). Reward of all beneficial and good deeds:įrom the cross-section of Ahadeeth of Rasul-ullah (Sallaho Alaihe Wassallam) Scholars have concluded that there is no restriction on the nature, type and number of optional good deeds which can be performed with the intention of passing the reward to other Muslims and the reward of the doer is not diminished in the least. The woman said, "O Allah's Apostle (Sallaho Alaihe Wassallam)! The obligation of Hajj enjoined by Allah on His devotees has become due on my father and he is old and weak, and he cannot sit firm on the Mount may I perform Hajj on his behalf?" The Prophet (Sallaho Alaihe Wassallam) replied, "Yes, you may." That happened during the Hajj-al-Wida (of the Prophet ). The Prophet (Sallaho Alaihe Wassallam) turned Al-Fadl's face to the other side. Would he be relieved of the burden of his sin if I give sadaqa on his behalf? He Allah's Apostle (Sallaho Alaihe Wassallam) said: Yes.Sayyidina Abdullah bin Abbas (RA) narrated that Al-Fadl (his brother) was riding behind Allah's Apostle (Sallaho Alaihe Wassallam) and a woman from the tribe of Khath'am came and Al-Fadl started looking at her and she started looking at him. ![]() ![]() Sayyidina Abu Huraira (RA) reported that a person said to Allah's Apostle (Sallaho Alaihe Wassallam): My father died and left behind property without making any will regarding it. The earth is forbidden from decomposing the bodies of the prophets of Allah (AS). He (RA) said, "O Allah's Apostle (Sallaho Alaihe Wassallam)! My mother died in my absence will it be of any benefit for her if I give Sadaqa on her behalf?" The Prophet (Sallaho Alaihe Wassallam) said, "Yes," Sad said, "I make you a witness that I gave my garden called Al Makhraf in charity on her behalf." Charity by children relieves the burden of sin of parents: ![]() Sayyidina Ibn 'Abbas (RA) narrated that mother of Sad bin 'Ubada (RA) died in his absence. Donating a garden in charity to the mother: Sayyidina Abu Huraira (RA) reported Allah's Messenger (Sallaho Alaihe Wassallam) as saying: When a man dies, his acts come to an end, but three, recurring charity, or knowledge (by which people) benefit, or a pious son, who prays for him (for the deceased). Rasul-ullah (Sallaho Alaihe Wassallam) has specifically spoken about three specific scenarios by which the dead can benefit after their death. There is nothing wrong with passing the reward of good deeds to family, friends and other Muslims whether they are dead or alive and it is hoped in the Mercy of Allah (SWT) that they will Insha'Allah be benefitted. 1/6/2024 0 Comments Unique visitors awstatsOther stats that Google Analytics can’t provide: For this reason these believers don’t use Google Analytics but AWstats instead. The GA urban legend states that if you have got an high bounce rate you might get penalised. More importantly AWstats gives you what Analytics will never be able to provide: Http error codes.Īs matter of fact Google Analytics can give you stats only on successfully returned pages (RC: 200) it is pretty much useless to diagnose 500 server errors, 404s and 403s.įurthermore there is a rumour in the SEO community that Google uses Google Analytics data (in particular Bounce Rate) to rate your site. It can analyse log files from all major server tools like Apache log files (NCSA combined/XLF/ELF log format or common/CLF log format), WebStar, IIS (W3C log format) and a lot of other web, proxy, wap, streaming servers, mail servers and some ftp servers. It uses a partial information file to be able to process large log files, often and quickly. AW Stats is basically a log analyser which works as a CGI or from command line and shows you all possible information your log contains in few graphics and web pages. Search engines, keyphrases and keywords used to find your siteĪWstats is what you need.Browsers used (pages, hits, KB for each browser, each version (Web, Wap, Media browsers: 97 browsers, more than 450 if using browsers_phone.pm library file),.Hosts list, last visits and unresolved IP addresses list,.Domains/countries of hosts visitors (pages, hits, KB, 269 domains/countries detected, GeoIp detection),.Days of week and rush hours (pages, hits, KB for each hour and day of week),.Authenticated users, and last authenticated visits,.Number of visits, and number of unique visitors,.If you are looking for a FREE and easy to use server side analytics package that tracks basic stats like: ![]() Sometimes Google Analytics doesn’t quite fit your needs – it can slow your site down (due to too many JS calls), or you can find it simply isn’t reliable enough. 1/6/2024 0 Comments Cant use jprofiler![]() ![]() NOTE: It is not recommended to use JProfiler in Production Environments …as it consumes more resources.which may not be desired in Production Envs.Īt the time of installation, you will be prompted for the installation key, copy it from your mail and paste it as shown in the screenshots. You will be asked to provide your name and e-mail id. * Provides visual representation for the virtual machine load in terms of active and total bytes, instances, threads, classes, Garbage Collector activity. * Enables both memory profile to assess memory usage and dynamic allocation leaks and CPU profiling to assess thread conflicts. cprofgcemetadataserverretrycount-cprofgcemetadataserverretrysleepsec: Together, these two options define the retry policy that the profiler agent uses when it communicates with the Compute Engine metadata service. If you are able to deal with those codes then go for it but if you not. About Press Copyright Contact us Creators Advertise Developers Terms Privacy Policy & Safety How YouTube works Test new features Press Copyright Contact us Creators. If the profiling agent can't communicate with the metadata service, then you need to use this option. The Android Profiler is compatible with Android 5.0 (API level 21) and higher. The Android Profiler tools provide real-time data to help you to understand how your app uses CPU, memory, network, and battery resources. Those files are corrupted and needs some surgery and reconstructions on the XML core that needs programming skills and at the sametime knowing Premiere pro projects XML mechanism. The Android Profiler in Android Studio 3.0 and higher replaces the Android Monitor tools. * JProfiler supports local profiling (analysis of applications running on the same machine as the JProfiler software) and remote profiling (analysis of Java applications running on remote machines) God forbid if you cant open any of them either, then dont waste your time anymore. The JProfiler tool window in IDEA is shown when you profile a run configuration from IDEA, when you open a JProfiler snapshot or when you attach to a running JVM. VM parameter as given by 'Session->Integration Wizards->New Remote Integration' or run the command line tool bin/jpenable on the remote machine to prepare a selected process for profiling. On the JProfiler tab of the IDE settings, you can adjust the used JProfiler executable and whether you always want to open a new window in JProfiler for new profiling sessions. You would either have to start the profiled JVM with the -agentpath. ![]() Also, you can only use the attach mode in your screen shot if the profiling agent is already loaded. * JProfiler works both as a stand-alone application and as a plug-in for the Eclipse software development environment. JProfiler does not use JMX to connect to a profiled JVM, it uses its own protocol. 1/6/2024 0 Comments Teamviewer download mac
1/6/2024 0 Comments The bon danceThree centuries later, the style remains as popular as ever-and it's not difficult to see why. The Cape Cod house form was first developed in America in the early 18th century. Nearby homes similar to 6040 Cape Cod Ln #52 have recently sold between $500K to $745K at an average of $545 per square foot. Pelham House Resort - Cape Cod 14 Sea Street, Dennis Port, MA 02639. Fun, friendly and luxurious- we're Cape Cod as it's meant to be experienced. Of course, a cocktail and a little time by an oceanfront fire pit might be just what you need. Reports say a woman was found dead following the fire, which broke out at a ranch in Marstons Mills. BARNSTABLE, MA - One person died in a fire on Cape Cod Sunday night. We strive to provide opinions, articles, discussions and history related to Hearth Products and in a more general sense, energy issues. ![]() Active since 1995, is THE place on the internet for free information and advice about wood stoves, pellet stoves and other energy saving equipment. The Plainville Fire Department said it started as a mulch fire and then spread to two units at the 10-unit complex. The fire started just before midnight on Messenger St. A fire broke out at a condo building overnight in Plainville, Massachusetts, displacing everyone living in the 10-unit complex.Additional wings on the sides or back of the home. Today’s quintessential Cape Cod is defined by: The original rectangular style, with a footprint that has more than doubled to include more rooms. Over the decades, the Cape Cod stayed true to its roots while growing and changing to accommodate modern life.Cotuit is a fire district of the town of Barnstable and has a population of. An interesting small town fire station of unusual design is that at Cotuit, Mass., on historic old Cape Cod. Firefighters discovered the fire had been burning for some time before they arrived on scene, according to the news station. Barnstable police told Boston 25 News a passerby reported the blaze at the 118 Lakeside Drive, Marstons Mills, home around 8 p.m. A woman died in a house fire that broke out Sunday night on Cape Cod.A woman called 911 after she noticed the flames. 1 Dead Following Cape Cod House Fire One person has died following a fire that broke out at a home Sunday night in Marstons Mills, Massachusetts.This segment aired on The Conversation on July 22, 2021. Last year, HPR featured a high school winner, Summer Royal, from ʻIolani School for her project on female astronauts breaking barriers.Ĭlick the "Listen" button to hear Tinkham's full interview and an excerpt from her project. The contest is one that Hawaiʻi students do well in. In her division, Tinkham was the first student from Hawaiʻi to win first place, competing against 100 students from the U.S., China, Korea, Malaysia and Singapore. But since people immigrated to Hawaiʻi, and they came from all over Japan, Hawaiʻi got this blend of cultures so they could do all the bon dances." "In Japan, every region has their own bon dance and they do that dance over and over. "Every motion in the bon dance means something, so I was able to understand it for the very first time," Tinkham told Hawaiʻi Public Radio. This time of the year does happen to be Bon Dance festival season, though some communities have turned to virtual events due to the pandemic. So I thought of the Bon Dance, which is the Japanese summer festival tradition." "I wanted to do something that focused on my cultural heritage because that was the whole reason why I wanted to do History Day. "Every year for National History Day, they have a theme and the theme this year was 'Communication in History,'" she said. Her entry, "The Rhythm of Resilience: Communication through the Bon Dance," took her on a journey of discovery of her Japanese roots through song, dance and drums. They were addressed to Lāʻie Elementary School sixth grader Keilani Kajiyama Tinkham for winning the top prize in the 2021 National History Day National Contest. A $1,000 check, a certificate, and a medal arrived in the mailbox of the Tinkham family on Oʻahu this week. ![]() 2YA ETN DF2 PW7 APA MRT MDA JKV GXM DK3 WLA AMP UBD AHQ TBB ADH NAS ADE YGL 4NU YEP 4EX 4NS 5N6 5UD 4AJ *V9 -X9.WHEELS: 17 X 6.0 STEEL CHROME CLAD, VOLTAGE MONITORING AUTO IDLE UP SYSTEM, TRANSMISSION: 6-SPEED AUTO AISIN AS69RC HD -inc: Urethane Shift Control, 3.73 Axle Ratio, Leather Wrapped Shift Control, Chrome Accent Shift Control.*This Ram 3500 Crew Cab 4x4 Comes Equipped with These Options *QUICK ORDER PACKAGE 2YA TRADESMAN -inc: Engine: 6.7L I6 Cummins Turbo Diesel, Transmission: 6-Speed Auto Aisin AS69RC HD, Urethane Shift Control, Halogen Quad Headlamps, Door Sill Scuff Pads, Glove Box, Exterior Mirrors w/Supplemental Signals, Map/Courtesy Lamp, Exterior Mirrors Courtesy Lamps, Trailer Tow Mirrors, Rear Dome Lamp, Exterior Mirrors w/Heating Element, Black Key Fob, Matte Black Grille Surround, Mirror Running Lights, Black Exterior Mirrors, Overhead Console, Overhead Cupholder Lamp, Power Black Trailer Tow Mirrors, MAX TOW PACKAGE -inc: 12.0 Dual Wheel Rear Axle, Add 4.10 Axle Ratio, TRAILER BRAKE CONTROL -inc: Trailer Light Check, TIRES: LT235/80R17E BSW ALL-SEASON, SIRIUSXM SATELLITE RADIO -inc: SiriusXM Radio Service, REMOTE KEYLESS ENTRY, RADIO: UCONNECT 5 W W/8.4 DISPLAY -inc: Google Android Auto, Bluetooth Handsfree Phone & Audio, SiriusXM Satellite Radio, SiriusXM Radio Service, Integrated Center Stack Radio, For Details, Visit, Connectivity - US/Canada, 4G LTE Wi-Fi Hot Spot, All Radio-Equipped Vehicles, Cluster 3.5 TFT Color Display, All R1 Low Radios, 8.4 Touchscreen Display, Apple CarPlay, MANUFACTURER'S STATEMENT OF ORIGIN, GVWR: 14,000 LBS, FULL SIZE SPARE TIRE -inc: Jack & Wrench.*Stop By Today *Test drive this must-see, must-drive, must-own beauty today at Larry H Miller Dodge Ram Avondale, 10101 W Papago Fwy, Avondale, AZ 85323.* is Arizona's favorite.*. Stock# 22P00190.This Ram 3500 Crew Cab 4x4 boasts an Intercooled Turbo Diesel I-6 6.7 L/408 engine powering this Automatic transmission. New 20 Crew Cab 4x4 10' Royal Contractor Body Work Truck for sale. 1/6/2024 0 Comments Screen marker alternativesClinical utility of total HCV core antigen quantification: a new indirect marker of HCV replication. doi: 10.1016/j.diagmicrobio.2016.11.010.īouvier-Alias M, Patel K, Dahari H, Beaucourt S, Larderie P, Blatt L, Hezode C, Picchio G, Dhumeaux D, Neumann AU, McHutchison JG, Pawlotsky JM. New direct-acting antivirals for patients with chronic HCV infection: can we monitor treatment using an HCV core antigen assay? Diagnostic Microbiology and Infectious Disease. Clinical Gastroenterology and Hepatology. ![]() Quantification of core antigen monitors efficacy of direct-acting antiviral agents in patients with chronic hepatitis C virus infection. As a result, a cost-effective strategy for screening and identifying active HCV carriers using HCV Ag detection would enable more patients access to efficacious and increasingly affordable direct-acting antivirals (DAAs) for the treatment of HCV infection.Īctive HCV infection HCV Ag HCV RNA Hepatitis C virus.Īghemo A, Degasperi E, De Nicola S, Bono P, Orlandi A, D’Ambrosio R, Soffredini R, Perbellini R, Lunghi G, Colombo M. We concluded that HCV Ag was a good surrogate marker for HCV RNA and could be used to diagnose active HCV infection in a resource-limited setting. To predict HCV viremia (HCV Ag ≥ 3 fmol/L), the accuracy, sensitivity, specificity, positive predictive value, and negative predictive value were 99%, 99%, 100%, 100% and 97%, respectively. HCV Ag significantly correlated with HCV RNA irrespective of HCV genotype and/or HBV co-infection (log HCV RNA = 2.67 + 0.95, R 2 = 0.890, p < 0.001). HCV genotype 1, 3, and 6 were identified. From 298 HCV-seropositive individuals evaluated for the presence of anti-HCV antibody, HCV Ag and HCV RNA, anti-HCV antibody was detected in 252 individuals (signal-to-cutoff ratios ≥5), HCV RNA was detected in 222 individuals (88%), and HCV Ag was reactive (≥3 fmol/L) in 220 individuals (87%). This study sought to evaluate the utility of HCV Ag as a marker to assess active HCV infection in individuals residing in an HCV-endemic area. Check in gInk to make sure your translation shows correctly, and then you can make a pull request to merge your translation to the next version of release for others to use.The core antigen of the hepatitis C virus (HCV Ag) presents an alternative marker to HCV RNA when screening patients for HCV viremia. Simply create a duplication of the file "en-us.txt" in "bin/lang" folder, rename it and then translate the strings in the file. Here is how you can contribute translation. You could check whether the fork project meets your needs if you want these features. The good news is that someone else (pubpub-zz) is actively working on a project ppInk which is based on gInk, adding many more functions to it including drawing lines, arrows, squared, texts etc. I indeed wish to add these features, but currently I haven't found a way to implement them while keeping the UI simple, which I weight more. Many have asked for features to draw lines, arrows, squares, texts etc.There are a few hidden options you can tweak in config.ini that are not shown in the options window.(do this only for gInk version v1.1.0 and after) ![]() If you use gInk on a computer with multiple displays of unmatched DPI settings, or you encounter problems such as incorrect snapshot area, being unable to drag toolbar to locations etc., please do the following as a workaround (in Windows 10 version 1903 as an example): right-click gInk.exe, Properties, Compatibility, Change high DPI settings, Enable override high DPI scaling behavior scaling performed by: Application.
|
AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |